General Information

  • ID:  hor000233
  • Uniprot ID:  A0A1S4EZN6
  • Protein name:  Pigment-dispersing hormone
  • Gene name:  5572286
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NSELINSLLSLPKKLNDA
  • Length:  18(86-103)
  • Propeptide:  MVNVQASFFVAICLCLSICASMPSYDDGIVDVDNEPFIRQLAELLAESDTNELSEIYSLPACRVCFYHLHNPYVNVVSNKRYGKRNSELINSLLSLPKKLNDAGK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces light-adaptive movement of pigment in distal eye pigment cells and?pigment dispersion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A1S4EZN6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000233_AF2.pdbhor000233_ESM.pdb

Physical Information

Mass: 227268 Formula: C86H149N23O29
Absent amino acids: CFGHMQRTVWY Common amino acids: L
pI: 6.49 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: -22.22 Boman Index: -2542
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 135.56
Instability Index: 2512.78 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti