HORDB

ID: hor000233
Uniprot ID: A0A1S4EZN6
Protein name: Pigment-dispersing hormone
Gene name: 5572286
Organism: Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Family: Arthropod PDH family
Source: animal
Expression: sinus gland
Disease: NA
Comments: NA
Taxonomy: Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0009416 response to light stimulus
GO CC: GO:0005576 extracellular region

Sequence: NSELINSLLSLPKKLNDA
Length: 18
Propeptide: MVNVQASFFVAICLCLSICASMPSYDDGIVDVDNEPFIRQLAELLAESDTNELSEIYSLPACRVCFYHLHNPYVNVVSNKRYGKRNSELINSLLSLPKKLNDAGK
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Induces light-adaptive movement of pigment in distal eye pigment cells and?pigment dispersion
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000233_AF2.pdb

hor000233_ESM.pdb

Mass:	227268	Formula:	C86H149N23O29
Absent amino acids:	CFGHMQRTVWY	Common amino acids:	L
pI:	6.49	Basic residues:	2
Polar residues:	6	Hydrophobic residues:	7
Hydrophobicity:	-22.22	Boman Index:	-2542
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	135.56
Instability Index:	2512.78	Extinction Coefficient cystines:	0
Absorbance 280nm:	0